PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_03960A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 274aa    MW: 29126.8 Da    PI: 7.6768
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_03960AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171462148
                               TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                               rg+W++eEde+l  +v+++G g +W + +++ g++R++k+c++rw++yl
  Oropetium_20150105_03960A 14 RGPWSPEEDEQLRSYVHRHGIGgNWIALPQKAGLNRCGKSCRLRWLNYL 62
                               89******************999************************97 PP

2Myb_DNA-binding37.45.8e-1271111446
                                S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                 T++Ed ++  + +  G++ W+ Ia++++ gRt++++k++w++
  Oropetium_20150105_03960A  71 YTEQEDRIICSLYNSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                                69*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.253966IPR017930Myb domain
SuperFamilySSF466896.27E-2811109IPR009057Homeodomain-like
SMARTSM007174.5E-121364IPR001005SANT/Myb domain
PfamPF002494.0E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-241569IPR009057Homeodomain-like
CDDcd001675.49E-101662No hitNo description
SMARTSM007172.9E-1167115IPR001005SANT/Myb domain
PROSITE profilePS5129414.41167117IPR017930Myb domain
PfamPF002491.1E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2170116IPR009057Homeodomain-like
CDDcd001678.38E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRAPCCDKS SVKRGPWSPE EDEQLRSYVH RHGIGGNWIA LPQKAGLNRC GKSCRLRWLN  60
YLRPDIRHGG YTEQEDRIIC SLYNSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKKAAMA  120
CSGTPPAQAL SPAASSASSS VTSSGSSGDG FFATLPPQTQ AQQGLVVRFD APPCRSPAEL  180
VAPPPALDGG VWASAPATGD SIAAMDDAFL SELVGGDQLF SSYGDFFGGP PPPQDRALEL  240
SACYFPNMVE MWGAAAAADH SHAKPQGLCN TLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794301e-133HF679430.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB24 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961299.11e-110PREDICTED: transcription factor RAX2-like
TrEMBLK3Z8K41e-110K3Z8K4_SETIT; Uncharacterized protein
STRINGSi022874m1e-109(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.15e-69myb domain protein 36